PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00008093001
Common NameGSBRNA2T00008093001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 365aa    MW: 40365 Da    PI: 6.2946
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00008093001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.4e-31193247155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr+rW+peLH++F+eav++L G+ekAtPk+++++m+v+gLt+++vkSHLQkYR+
  GSBRNA2T00008093001 193 KPRMRWSPELHDCFLEAVKKLDGPEKATPKAVMKMMNVEGLTIYQVKSHLQKYRI 247
                          79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.143190250IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-29191248IPR009057Homeodomain-like
SuperFamilySSF466899.5E-18192248IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-25193248IPR006447Myb domain, plants
PfamPF002492.6E-10195246IPR001005SANT/Myb domain
PfamPF143799.3E-22285331IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MNSHSLLSID GGNTSCSSSS LSPVHNFHPT ETTTRSFQFK PSHFSNGSFS RCSSFCNLSS  60
SSSSDTQKHL GSTLPFLPNP LTENERSPAA ASFTDGDLLS IPYEEEVDPS FLSLHGDGGF  120
QDVDNFSLSE EQMELQFLSD ELQLAITDRA QTPRLDEIYQ VTGSSPGQNC VPAAMPVLSQ  180
QPSPGGTEAV NQKPRMRWSP ELHDCFLEAV KKLDGPEKAT PKAVMKMMNV EGLTIYQVKS  240
HLQKYRIAKH MPERKEEKKS GGNPEDKKPA SNTNGEANGR KKGAIQITEA LRMQMEVQKQ  300
LHQQLEVQRS LQLRIEEHAK YLEKILDEQR KATPTSKQES QLSSASSAKD DECQASPKRP  360
RIEN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00008093001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147458.10.0PREDICTED: uncharacterized protein LOC103871004
TrEMBLA0A078IPE70.0A0A078IPE7_BRANA; BnaA06g00030D protein
STRINGBra038033.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1913667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-106G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]